PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00081201001
Common NameGSBRNA2T00081201001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 314aa    MW: 36185.4 Da    PI: 7.0064
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00081201001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.53.1e-281367155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrW+ eLH+rF++av+qLGG++kAtPk ++++++++ Ltl+h+kS LQkYRl
  GSBRNA2T00081201001 13 KPRLRWSYELHHRFINAVNQLGGPNKATPKGLMRVLEIPELTLYHLKSYLQKYRL 67
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-261069IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-181367IPR006447Myb domain, plants
SuperFamilySSF466895.02E-131370IPR009057Homeodomain-like
PfamPF143791.7E-18113159IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MDNDKNHKTE EPKPRLRWSY ELHHRFINAV NQLGGPNKAT PKGLMRVLEI PELTLYHLKS  60
YLQKYRLGIS ERFIGNKQDA GRSQECQSRE DFGDQLDIIV TEEKHDEPNK NLQNKEAMEI  120
QMEVQKKLHE QIETQQQLQV RIEAQGKYLQ SVLLKAQETL SGYNSFNLYA VASMANRNCL  180
SSSFSAPTQA DEDNEVEEEY DFLCTKKPEN RGNASTRSSV DCSLASSESS EAKQDHHSQN  240
NMRRSDKLQF MEIKPEEVMD RNKRRWDDVL CVEQSNRKRS FKGHDGEDLG LGLNSFKVME  300
TSYKSKSKSK SNK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893850.0AC189385.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB052E19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013600749.10.0PREDICTED: myb family transcription factor APL-like isoform X2
TrEMBLA0A078I5510.0A0A078I551_BRANA; BnaCnng12310D protein
TrEMBLA0A0D3DR880.0A0A0D3DR88_BRAOL; Uncharacterized protein
STRINGBra016289.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.14e-92G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]